Protein Info for EX28DRAFT_1950 in Enterobacter asburiae PDN3

Annotation: OHCU decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 166 TIGR03180: OHCU decarboxylase" amino acids 7 to 164 (158 residues), 194.3 bits, see alignment E=7e-62 PF09349: OHCU_decarbox" amino acids 8 to 161 (154 residues), 146.2 bits, see alignment E=6.2e-47

Best Hits

KEGG orthology group: None (inferred from 75% identity to enc:ECL_02667)

MetaCyc: 63% identical to OHCU decarboxylase (Klebsiella pneumoniae pneumoniae MGH 78578)
RXN-6201 [EC: 4.1.1.97]

Predicted SEED Role

"Uricase (EC 1.7.3.3)" (EC 1.7.3.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.7.3.3

Use Curated BLAST to search for 1.7.3.3 or 4.1.1.97

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (166 amino acids)

>EX28DRAFT_1950 OHCU decarboxylase (Enterobacter asburiae PDN3)
MIALHDFNHLPHEKALALIHPCVALPEWADALALGRPYASRDELFSTANALTQAWGEAAL
AQALSAHPRIGEKPAGSQAEAALSRQEQGAVNDRDAALAQALREGNARYEARFGRVFLIR
AKGRSGEDILQALHARLENSDAQEVRAALEQLREITLLRLEGVISE