Protein Info for EX28DRAFT_1949 in Enterobacter asburiae PDN3

Annotation: hydroxyisourate hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 107 TIGR02962: hydroxyisourate hydrolase" amino acids 2 to 107 (106 residues), 91.5 bits, see alignment E=2.2e-30 PF00576: Transthyretin" amino acids 4 to 106 (103 residues), 92.6 bits, see alignment E=1.2e-30

Best Hits

KEGG orthology group: K07127, 5-hydroxyisourate hydrolase [EC: 3.5.2.17] (inferred from 86% identity to enc:ECL_02666)

MetaCyc: 64% identical to hydroxyisourate hydrolase (Klebsiella michiganensis M5al)
Hydroxyisourate hydrolase. [EC: 3.5.2.17]

Predicted SEED Role

"5-Hydroxyisourate Hydrolase (HIUase) (EC 3.5.2.17)" (EC 3.5.2.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.2.17

Use Curated BLAST to search for 3.5.2.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (107 amino acids)

>EX28DRAFT_1949 hydroxyisourate hydrolase (Enterobacter asburiae PDN3)
MSTLSTHILDISTGKPAEGVTVHLQQDGNTLATGVTNAQGRIAAFVPSLPAGRYRLVAEI
GAWFSETGRDTLYPCAQIDFVTGEAAGEHFHLPFVIAPGGWSTYRGS