Protein Info for EX28DRAFT_1936 in Enterobacter asburiae PDN3

Annotation: amine acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 transmembrane" amino acids 27 to 48 (22 residues), see Phobius details amino acids 68 to 87 (20 residues), see Phobius details amino acids 93 to 112 (20 residues), see Phobius details amino acids 150 to 174 (25 residues), see Phobius details amino acids 189 to 209 (21 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 19 to 113 (95 residues), 86.2 bits, see alignment E=8.8e-29 PF00528: BPD_transp_1" amino acids 52 to 218 (167 residues), 54.8 bits, see alignment E=5.3e-19

Best Hits

Swiss-Prot: 32% identical to YECS_SHIFL: L-cystine transport system permease protein YecS (yecS) from Shigella flexneri

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 96% identity to enc:ECL_02652)

MetaCyc: 32% identical to cystine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-290 [EC: 7.4.2.12]; 7.4.2.12 [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]

Predicted SEED Role

"Putative amino acid ABC transporter, permease protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (225 amino acids)

>EX28DRAFT_1936 amine acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family (Enterobacter asburiae PDN3)
MAGGAGMMTTFTDWDIIRNLLLAGRWTVLLSLVAFVGGAAVTLPLLLLRLTGGRTVKRII
RGYIELFQGTPLLMQLFLAFFGVALFGIDVSPWTAASLALTFYTSAFLLDIWNGSIRALP
KGQWEASRCLGLTFGQTLFRVVAPQALRIGIAPTVGFAVQVIKGTALASIIGFIELTKAG
TMLTNVTYQPFKVFALVALGYFILCYPLSRYSRYLETKFNASHHH