Protein Info for EX28DRAFT_1933 in Enterobacter asburiae PDN3

Annotation: amidase, hydantoinase/carbamoylase family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 TIGR01879: amidase, hydantoinase/carbamoylase family" amino acids 15 to 399 (385 residues), 389.8 bits, see alignment E=7.2e-121 PF04389: Peptidase_M28" amino acids 59 to 140 (82 residues), 31.2 bits, see alignment E=2.8e-11 PF01546: Peptidase_M20" amino acids 75 to 403 (329 residues), 74 bits, see alignment E=2.5e-24 PF07687: M20_dimer" amino acids 210 to 309 (100 residues), 25.4 bits, see alignment E=1.8e-09

Best Hits

KEGG orthology group: K02083, allantoate deiminase [EC: 3.5.3.9] (inferred from 87% identity to enc:ECL_02649)

Predicted SEED Role

"N-carbamoyl-L-amino acid hydrolase (EC 3.5.1.87)" in subsystem Hydantoin metabolism (EC 3.5.1.87)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.87

Use Curated BLAST to search for 3.5.1.87 or 3.5.3.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (412 amino acids)

>EX28DRAFT_1933 amidase, hydantoinase/carbamoylase family (Enterobacter asburiae PDN3)
MSPAAERVMARADALAAISENPDALTRVYLSTQHLQANQLVGQWMSQAGMTVWQDSVGNI
CGRYEGAQEGAQAVLLGSHLDTVRNAGRYDGMLGVLAAIEVVDSLHQQGVHLALAIEIVG
FCDEEGTRFGITLLGSRGLTGTWPQGWLEKADASGISVAQAMTLVGLDPARVLHAARRQE
DFSAYLELHIEQGPCLEQEALALGVVEAINGARRLNCRFTGEAGHAGTVPMHHRRDALAA
AAEWMVIIENATRQQGGNLVATVGELRCLPGAVNVIPGEVQLSLDIRGPQDAPLDRLLND
LLEHAQAIASRRGLDFSAEEFYRIAATPCDIHLQNVLGEAVTSVQGRSLSLPSGAGHDAI
AIAERWPVGMLFVRCKEGVSHHPAESVMAEDVALAIEAFGLAVRTLADGGPC