Protein Info for EX28DRAFT_1865 in Enterobacter asburiae PDN3

Annotation: Uncharacterized protein conserved in bacteria

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 PF04337: DUF480" amino acids 5 to 158 (154 residues), 211.6 bits, see alignment E=2.8e-67

Best Hits

Swiss-Prot: 83% identical to Y1581_ENT38: UPF0502 protein Ent638_1581 (Ent638_1581) from Enterobacter sp. (strain 638)

KEGG orthology group: K09915, hypothetical protein (inferred from 89% identity to enc:ECL_02571)

Predicted SEED Role

"Protein of unknown function YceH" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (218 amino acids)

>EX28DRAFT_1865 Uncharacterized protein conserved in bacteria (Enterobacter asburiae PDN3)
MKYQLNGTEARVIGCLLEKQVTTPEQYPLSVNAVTMACNQKTNREPVMNLSEHEVQDVLD
ALVKRHYLRTVSGFGNRVTKYEQRFCNSEFGDLKLSSAEVAVITTLLLRGAQTPGELRTR
ASRMHEFSDMQEVEQTLEGLASREDGPYVVRLAREPGKRESRYMHLFSGDVDVATATVES
DAGSSASNDTLAARVEALEEEVAGLKQRLDALLAHLGD