Protein Info for EX28DRAFT_1835 in Enterobacter asburiae PDN3

Annotation: acyl carrier protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 78 TIGR00517: acyl carrier protein" amino acids 1 to 77 (77 residues), 126 bits, see alignment E=2.1e-41 PF00550: PP-binding" amino acids 6 to 73 (68 residues), 58.1 bits, see alignment E=4.4e-20

Best Hits

Swiss-Prot: 99% identical to ACP_ERWT9: Acyl carrier protein (acpP) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K02078, acyl carrier protein (inferred from 97% identity to ecf:ECH74115_1473)

MetaCyc: 97% identical to acyl carrier protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Acyl carrier protein" in subsystem Fatty Acid Biosynthesis FASII or Glycerolipid and Glycerophospholipid Metabolism in Bacteria or mycolic acid synthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (78 amino acids)

>EX28DRAFT_1835 acyl carrier protein (Enterobacter asburiae PDN3)
MSTIEERVKKIIGEQLGVKQEEVVNSASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA
EKITTVQAAIDYINGHQA