Protein Info for EX28DRAFT_1782 in Enterobacter asburiae PDN3

Annotation: Glutamine amidotransferase class-I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00117: GATase
  • amino acids 50 to 205 (156 residues), 33.7 bits, E=1.5e-12

Best Hits

KEGG orthology group: None (inferred from 95% identity to enc:ECL_02486)

Predicted SEED Role

"CTP synthase (EC 6.3.4.2)" (EC 6.3.4.2)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (46/46 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
• superpathway of pyrimidine ribonucleosides salvage (10/10 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (9/9 steps found)
• superpathway of pyrimidine nucleobases salvage (4/4 steps found)
• UTP and CTP de novo biosynthesis (3/3 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (3/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)
• L-glutamate and L-glutamine biosynthesis (5/7 steps found)
• UTP and CTP dephosphorylation I (5/7 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)
• UTP and CTP dephosphorylation II (1/3 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.4.2

Use Curated BLAST to search for 6.3.4.2

Protein Sequence (235 amino acids)

>EX28DRAFT_1782 Glutamine amidotransferase class-I (Enterobacter asburiae PDN3)
MEHLPVKTTLRIALVGDYNPSVIAHQAIPLAIDDAAAVLDLTADYDWLATTELTSPEDLV
GYDAIWLVPASPYKNTEAAFIAARYARENGIPFLGTCGGFQHALIEYARNVLGWADAAHA
ETDTEGTMVIAPLTCSLVEKTDAIELRKNTLIAKAYGKPEIEEGYHCNYGVSPAFSQALE
SGDMHVTGWDEQGEIRAAELVTHPFFVITLFQHERAALEGRPVVLVQAMLRAARG