Protein Info for EX28DRAFT_1759 in Enterobacter asburiae PDN3

Annotation: Phosphatidylglycerophosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 transmembrane" amino acids 34 to 60 (27 residues), see Phobius details amino acids 81 to 104 (24 residues), see Phobius details amino acids 110 to 134 (25 residues), see Phobius details amino acids 160 to 189 (30 residues), see Phobius details PF01066: CDP-OH_P_transf" amino acids 27 to 188 (162 residues), 41.2 bits, see alignment E=1.2e-14

Best Hits

Swiss-Prot: 85% identical to YNJF_ECOLI: Inner membrane protein YnjF (ynjF) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 92% identity to enc:ECL_02456)

Predicted SEED Role

"Putative phosphatidylglycerophosphate synthase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (205 amino acids)

>EX28DRAFT_1759 Phosphatidylglycerophosphate synthase (Enterobacter asburiae PDN3)
MLDRHLHPRVKPVLNRLVSVMDKPGITPDGLTLTGFAIGVLALPFLALGWYPAALAAIVL
NRLLDGLDGALARRRGLTDAGGFLDIALDFLFYALVPFGFALAAPAENALAAAWLLFAFI
GTGSSFLAFAALAAKHDIDNPGYAHKSFYYIGGLTEGTETIALFVLCCLFPAHFTLFAWV
FGALCWLTTTTRVWSGYVTLKSLNP