Protein Info for EX28DRAFT_1756 in Enterobacter asburiae PDN3

Annotation: ABC-type uncharacterized transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 509 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 55 to 80 (26 residues), see Phobius details amino acids 92 to 111 (20 residues), see Phobius details amino acids 131 to 155 (25 residues), see Phobius details amino acids 178 to 202 (25 residues), see Phobius details amino acids 238 to 260 (23 residues), see Phobius details amino acids 284 to 305 (22 residues), see Phobius details amino acids 316 to 335 (20 residues), see Phobius details amino acids 344 to 364 (21 residues), see Phobius details amino acids 376 to 397 (22 residues), see Phobius details amino acids 418 to 442 (25 residues), see Phobius details amino acids 479 to 501 (23 residues), see Phobius details

Best Hits

KEGG orthology group: K05778, putative thiamine transport system permease protein (inferred from 78% identity to enc:ECL_02453)

Predicted SEED Role

"ABC transporter, permease protein YnjC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (509 amino acids)

>EX28DRAFT_1756 ABC-type uncharacterized transport system, permease component (Enterobacter asburiae PDN3)
MAASLRHPLSGLVWLAMAVIYLPILPAGVMLFAPALSATNWQRLLNDPQLPQATVATLVS
TLIATLGALLIALFFVCLLWPGQRWRRLTTRLPWLLAIPHVAFATSALLLFSEGGLFYQL
CTVCTAPFDRYGVGLGLTLAVKESAFVLWAIYAVLPEQRLAQQKIVLQTFGYGRIQTLSW
LILPAIAPVLGAVMLAVLAWSLSVVDVAIVLGPGNPPTLAVLAFQWLSQGDAQQQAKGTL
LCLLLLMLLAALAALGYGLWKAWRRTIPNLAGTRPRSPLVLPERAFGGLLPACGILCAAV
LLMQAQGGDVGPVGTSFSFGLLSSLIALIVIFLWLEWGPQRGAVWVWSPLALPALPLVTG
QYFIALRLGLDGHYAAVLWSHLLWVLPWMLLVLQPAWRRIDPRLILTARTLGWRRAKIFL
LLKCPLLVRPALLAFATGFSVSMAQYMPTLWLGAGRFATLTTETVALSSGGSIPVLASRA
LGLLLVTGTVFGLAALISRLAGRYRQGLR