Protein Info for EX28DRAFT_1688 in Enterobacter asburiae PDN3

Annotation: MerR HTH family regulatory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 PF13411: MerR_1" amino acids 4 to 72 (69 residues), 71.8 bits, see alignment E=8.6e-24 PF00376: MerR" amino acids 5 to 42 (38 residues), 48.2 bits, see alignment 1.5e-16 PF22270: MlrA_helical" amino acids 81 to 155 (75 residues), 84.5 bits, see alignment E=8.9e-28 PF22267: MlrA_C" amino acids 162 to 238 (77 residues), 128 bits, see alignment E=2.7e-41

Best Hits

Swiss-Prot: 65% identical to BLUR_ECOLI: HTH-type transcriptional repressor BluR (bluR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 94% identity to enc:ECL_02371)

Predicted SEED Role

"Putative HTH-type transcriptional regulator ycgE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (242 amino acids)

>EX28DRAFT_1688 MerR HTH family regulatory protein (Enterobacter asburiae PDN3)
MAYYSIGEVAERCGINPVTLRAWQRRYGLLKPQRSEGGHRQFDDEDILRIEEIKRLMKSG
VSVGKVKALLENKEVLTQGNWVSFQEEMMTVLRYASPAKLRAKMGEFRRDHAIDALIDNI
ISPVRQRMNQDQNTVRHMASLFDGVLIEFAIASLAESRKKIGKDALLIGWECDDRTHLWL
EAARLSQKGWHIDVLAEPIDSPRPELFPGQKIFVWTGKAPTPRQQEQLDHWREQGFAVSF
HH