Protein Info for EX28DRAFT_1677 in Enterobacter asburiae PDN3

Annotation: Cysteine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 PF00291: PALP" amino acids 7 to 301 (295 residues), 246.7 bits, see alignment E=3.5e-77 PF00571: CBS" amino acids 344 to 389 (46 residues), 40.8 bits, see alignment 2.3e-14 amino acids 402 to 449 (48 residues), 21.3 bits, see alignment 2.8e-08

Best Hits

KEGG orthology group: K01697, cystathionine beta-synthase [EC: 4.2.1.22] (inferred from 95% identity to enc:ECL_02360)

Predicted SEED Role

"Cystathionine beta-synthase (EC 4.2.1.22)" in subsystem Cysteine Biosynthesis or Glycine and Serine Utilization or Methionine Biosynthesis or Methionine Degradation (EC 4.2.1.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (456 amino acids)

>EX28DRAFT_1677 Cysteine synthase (Enterobacter asburiae PDN3)
MTIYHSVTELIGRTPLIQLHKLDTGPCSLFLKLENQNPGGSIKDRVALSMINEAERTGQL
KPGGTIIEATAGNTGLGLALIAAQKGYSLILVVPDKMSREKIFHLRALGAQVVLTRSDVN
KGHPAYYQDYAQRLANELPGAFYIDQFNNEANPLAHRTTTAPELYEQLDGQIDAIVVGVG
SGGTLGGLQAWFAEHSPHTEFVLADPAGSVLADQVETGRYHDAGSWLVEGIGEDFIPPLA
HIEGVNRAWRITDREAFTTARELLKTEGILAGSSSGTLLAAALKYCQAQTAPKRVVTFAC
DSGNKYLSKMFNDDWMRQQGLITRPQAGDLSDYIALRHDEGATVTAAPDDTLSTVLARMR
LYDISQLPVLENGKVVGIIDEWDLLRHIGGDGDRFALPVTAAMTRQVEFLDKHAPESALN
AIFDRGLVAVINDNDRFLGLITRSDVLTAWRNRLQQ