Protein Info for EX28DRAFT_1671 in Enterobacter asburiae PDN3

Annotation: amine acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 transmembrane" amino acids 20 to 46 (27 residues), see Phobius details amino acids 58 to 80 (23 residues), see Phobius details amino acids 107 to 129 (23 residues), see Phobius details amino acids 160 to 175 (16 residues), see Phobius details amino acids 178 to 179 (2 residues), see Phobius details amino acids 213 to 235 (23 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 16 to 80 (65 residues), 57.1 bits, see alignment E=1.1e-19 PF00528: BPD_transp_1" amino acids 33 to 237 (205 residues), 51 bits, see alignment E=7.7e-18

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 80% identity to ent:Ent638_1777)

Predicted SEED Role

"Glutamate Aspartate transport system permease protein GltJ (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (258 amino acids)

>EX28DRAFT_1671 amine acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family (Enterobacter asburiae PDN3)
MPALDWQGVLTGQPLQWILSGFLTTLWVTLAGMLLASLLALLFMLLRLSGGRPGNAVVSC
WVSLFRNTPLLVQLLFWYFAAWNGLPQAFRDAVNADHSWSILPGDVWWFTPEFLCSAWGL
GVFTSAFLIEEVESGLRSVPAGQREAALAQGFSAWRLFRYILLPQGLANAWQPVVGQYLN
LMKLSSLASGIGFAELTYQVRQIESYNAHALEAFTLGTALYLLTGLVMGIVLVRIGPEAK
RKRQNVATSGSEKYDCRT