Protein Info for EX28DRAFT_1536 in Enterobacter asburiae PDN3

Annotation: amidohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 TIGR01891: amidohydrolase" amino acids 17 to 419 (403 residues), 392.6 bits, see alignment E=9.6e-122 PF01546: Peptidase_M20" amino acids 112 to 428 (317 residues), 118.6 bits, see alignment E=3.6e-38 PF07687: M20_dimer" amino acids 231 to 319 (89 residues), 41.7 bits, see alignment E=1e-14

Best Hits

Swiss-Prot: 78% identical to IAAH_ENTAG: Indole-3-acetyl-aspartic acid hydrolase (iaaH) from Enterobacter agglomerans

KEGG orthology group: K12940, aminobenzoyl-glutamate utilization protein A (inferred from 92% identity to enc:ECL_02255)

MetaCyc: 76% identical to p-aminobenzoyl-glutamate hydrolase subunit A (Escherichia coli K-12 substr. MG1655)
3.5.1.-

Predicted SEED Role

"Catalyzes the cleavage of p-aminobenzoyl-glutamate to p-aminobenzoate and glutamate, subunit A" in subsystem p-Aminobenzoyl-Glutamate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (436 amino acids)

>EX28DRAFT_1536 amidohydrolase (Enterobacter asburiae PDN3)
MDTLAQYIQTLSPQLSAWRRDFHHFAESGWVEFRTAAKVAEILDALGYELAMGRDVVDAE
SRMGLPDAATLAQEFSRARAQGAPEKWLAPFEGGFTGIVATLNTGRPGPTLAFRVDMDAL
DLSEALDESHRPFRNGFASCNAGMMHACAHDGHTAIGLGLAQVLKHNEAKLNGTLKLIFQ
PAEEGTRGARAMVAAGALDDVDYFTAIHIGTGVPAGTVICGSDNFMATTKFDVNFTGVAA
HAGGKPEDGRNALLAAAQAALALHSIAPHSEGASRVNVGVMQAGSGRNVVPANALIKVET
RGESEAINQYVFERAQAVITGAAALYGVSAEMRLMGAATSSAPTPAWVDYLREQTSQVSG
VVHAIDKVKAPAGSEDATLMMARVQENGGMASYMVFGTDLSAGHHNEKFDFDEQVMAIAI
ETLARTALNFPWTRGV