Protein Info for EX28DRAFT_1489 in Enterobacter asburiae PDN3

Annotation: ABC-type proline/glycine betaine transport systems, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 51 to 73 (23 residues), see Phobius details amino acids 79 to 100 (22 residues), see Phobius details amino acids 132 to 150 (19 residues), see Phobius details amino acids 153 to 176 (24 residues), see Phobius details amino acids 183 to 202 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 36 to 205 (170 residues), 84.2 bits, see alignment E=4.9e-28

Best Hits

Swiss-Prot: 93% identical to OSMW_SALTY: Osmoprotectant import permease protein OsmW (osmW) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K05846, osmoprotectant transport system permease protein (inferred from 99% identity to enc:ECL_02215)

Predicted SEED Role

"Putative binding-protein-dependent transport system"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (215 amino acids)

>EX28DRAFT_1489 ABC-type proline/glycine betaine transport systems, permease component (Enterobacter asburiae PDN3)
METIHYILDNRDYLLTLTLQHLWLVALAVGLAIIIGVPLGILIVRHRWLATPVLGIATIV
LTIPSIALFGLMIPLFSLIGQGIGALPAITAVFLYSLLPIVRNTHTALDSLPPGLREAGR
GIGMTFWQRLRWVEIPMALPVIFGGIRTAVVMNIGVMAIAAVIGAGGLGLLLLNGIGGSD
IRMLIAGALMICLLAIVLDWLLHRLQVVLTPKGIR