Protein Info for EX28DRAFT_1429 in Enterobacter asburiae PDN3

Annotation: AraC-type DNA-binding domain-containing proteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 PF14525: AraC_binding_2" amino acids 13 to 183 (171 residues), 83.4 bits, see alignment E=2.5e-27 PF12833: HTH_18" amino acids 220 to 300 (81 residues), 71.8 bits, see alignment E=7e-24 PF00165: HTH_AraC" amino acids 261 to 299 (39 residues), 33.6 bits, see alignment 5.1e-12

Best Hits

Swiss-Prot: 64% identical to FEAR_ECOLI: Transcriptional activator FeaR (feaR) from Escherichia coli (strain K12)

KEGG orthology group: K14063, AraC family transcriptional regulator, positive regulator of tynA and feaB (inferred from 88% identity to enc:ECL_02161)

Predicted SEED Role

"Transcriptional activator feaR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (302 amino acids)

>EX28DRAFT_1429 AraC-type DNA-binding domain-containing proteins (Enterobacter asburiae PDN3)
MACASEQEQYQQWLAQINQVCGRFNAQPTGGKFFGELETSYARSLKLSTVTAGGVNLFRS
RQEIAQSNDAWFYTVFQLEGSAEIEQDDRRALLRTGDITLIDASRPCSINWREKSRQISL
LVPRQIIEQQCRFQEISCATALSRTLPTVQLSHRLLMESMSNADLSDRESEAALEAMICL
LRPAFQQREIIQPRKERQFQHVVALIDDHIQSESLRPEWIAAESGMSVRSLYRMFAEKGL
VVAQYIKNRRLDLCAQALQSTGDDEKLAGIGYSWGFTDHSHFSTAFKQRFGVSPGEYRRR
YR