Protein Info for EX28DRAFT_1414 in Enterobacter asburiae PDN3

Annotation: phenylacetate degradation probable enoyl-CoA hydratase paaB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 TIGR02280: phenylacetate degradation probable enoyl-CoA hydratase PaaB" amino acids 4 to 261 (258 residues), 463.4 bits, see alignment E=1e-143 PF00378: ECH_1" amino acids 9 to 260 (252 residues), 210 bits, see alignment E=3.8e-66 PF16113: ECH_2" amino acids 13 to 197 (185 residues), 122.9 bits, see alignment E=2.2e-39

Best Hits

Swiss-Prot: 88% identical to PAAG_ECOLI: 1,2-epoxyphenylacetyl-CoA isomerase (paaG) from Escherichia coli (strain K12)

KEGG orthology group: K01692, enoyl-CoA hydratase [EC: 4.2.1.17] (inferred from 95% identity to enc:ECL_02147)

MetaCyc: 63% identical to 1,2-epoxyphenylacetyl-CoA isomerase (Pseudomonas sp. Y2)
RXN0-6510 [EC: 5.3.3.18]

Predicted SEED Role

"Phenylacetate degradation enoyl-CoA hydratase PaaB (EC 4.2.1.17)" (EC 4.2.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.17

Use Curated BLAST to search for 4.2.1.17 or 5.3.3.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (261 amino acids)

>EX28DRAFT_1414 phenylacetate degradation probable enoyl-CoA hydratase paaB (Enterobacter asburiae PDN3)
MEFILSHVEQGVMTITLNRPERLNSFNDVMHQQLAECLKQAERDDTVRCLLITGAGRGFC
AGQDLNDRNVDPNGPAPDLGMSVETFYNPLVRRLAKLPKPVICAVNGVAAGAGATLALGC
DMVIAARSANFVMAFSKLGLVPDCGGTWLLPRVAGRARAMGLALLGDKLSAERAQAWGMI
WQVVDDEQLSTTAQQMALHFASQPTFGLGLIKQAINAAETNTLDAQLDLERDYQRLAGRS
DDYREGVSAFLAKRAPNFTGK