Protein Info for EX28DRAFT_1385 in Enterobacter asburiae PDN3

Annotation: Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00106: adh_short" amino acids 5 to 182 (178 residues), 63.3 bits, see alignment E=4.4e-21 PF23441: SDR" amino acids 5 to 237 (233 residues), 64.8 bits, see alignment E=1.7e-21 PF08659: KR" amino acids 6 to 119 (114 residues), 33.8 bits, see alignment E=6.5e-12 PF13561: adh_short_C2" amino acids 11 to 235 (225 residues), 93.3 bits, see alignment E=3.7e-30

Best Hits

KEGG orthology group: None (inferred from 54% identity to vsp:VS_II1477)

Predicted SEED Role

"Glucose 1-dehydrogenase (EC 1.1.1.47)" in subsystem D-gluconate and ketogluconates metabolism or Entner-Doudoroff Pathway (EC 1.1.1.47)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.47

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (239 amino acids)

>EX28DRAFT_1385 Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) (Enterobacter asburiae PDN3)
MTHKTLIIGGASGIGFAVGSLLAGRGEEIILAGRDGAKLDAARQRLSAHAASVHTLVLDI
SREAELVALGETLGEVNNIVVTAGSQAPGGLLSGLDLRAARLAFDTKFWGSINVARYLSG
NIAPRGTLTFTSGFVARRTVAGAIVKTTMNAAIEAATKVLAKELSPLRVNVVSPGLTDTE
AYAGMDASAREKMLTAAAESLPAKAWGRAEDVAQGYLFAIDNPFVTGSVIDIEGGALIN