Protein Info for EX28DRAFT_1119 in Enterobacter asburiae PDN3

Annotation: Lysophospholipase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 493 transmembrane" amino acids 15 to 37 (23 residues), see Phobius details amino acids 232 to 256 (25 residues), see Phobius details PF12146: Hydrolase_4" amino acids 124 to 244 (121 residues), 45.8 bits, see alignment E=7.3e-16 PF00561: Abhydrolase_1" amino acids 128 to 219 (92 residues), 34.7 bits, see alignment E=2.3e-12 PF12697: Abhydrolase_6" amino acids 129 to 273 (145 residues), 38 bits, see alignment E=4.6e-13

Best Hits

KEGG orthology group: None (inferred from 86% identity to enc:ECL_01926)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (493 amino acids)

>EX28DRAFT_1119 Lysophospholipase (Enterobacter asburiae PDN3)
MANLPWRVSVRLMALAKKIGIVVGIVLVVLLAVRVYLSQQGPELHLWHTWRADEMSVREM
DNADFAGYIARENAIFADLDRAVMVKTEGEERTPLNRYYRQSLVWPGQFTPDANRSFVLM
PAGKPRGAVVLLHGLTDSPYSVRRLAVNYQQHGFVAVVPRLPGHGTAPGALTDVDWEMWL
AATRLAVREATRLAGEAAPLHLVGYSNGGALAMKYTLDALDAPSLRKPQQVILLSPMIGV
TAFARFAGFAGLPALLPAFAKAAWLNISPEYNPYKYNSFPVNAARQSWLLTKALQEQIGR
EARENRLENLPPVLAFQSVMDSTVSTRAVVTGLFDQLPANGSELVVFDINQAASFRPLFK
PSSWTATSALLPVAQRRYGVTIITNADAHSFSTVAKITPAGSTRETVVPLAQAWPQDVYS
LSHVAVPFPPDDDLYGREPGVKNRYGISLGTIALWGETSVLSVGKEALMRVTSNPFYGYM
QERINSRIGDAEK