Protein Info for EX28DRAFT_1078 in Enterobacter asburiae PDN3

Annotation: Branched-chain amino acid ABC-type transport system, permease components

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 42 to 61 (20 residues), see Phobius details amino acids 67 to 89 (23 residues), see Phobius details amino acids 102 to 123 (22 residues), see Phobius details amino acids 151 to 175 (25 residues), see Phobius details amino acids 202 to 224 (23 residues), see Phobius details amino acids 230 to 250 (21 residues), see Phobius details amino acids 257 to 275 (19 residues), see Phobius details amino acids 290 to 308 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 8 to 300 (293 residues), 164.4 bits, see alignment E=1.5e-52

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 94% identity to cko:CKO_02933)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (316 amino acids)

>EX28DRAFT_1078 Branched-chain amino acid ABC-type transport system, permease components (Enterobacter asburiae PDN3)
MDTLIQQLINGVMLGSIYALIALGYTMVYGILRIINFAHGDILMVGALTTLSAINALNAT
FPHMPLLLQLGVALVIAMAVCALLAMAVERFAYRRLRNAPRLAPLISGIGVSVLLQTVAM
IIWTRNPLMFPQILPMEPIAVTSGSELHPPAIVTVTGIVTVALALAVMTGLWLLVEYTRL
GRGMRAVAENPRVATLMGVNPNAIITLTFAIGGVFAALAGVMMASNYGNASFSMGFLPGI
KAFTAAVLGGIGNIRGAMIGGILLGIIEALGAGYLGELTHGVFGSNYQDVFAFMVLILVL
VFRPAGLLGERVAHRA