Protein Info for EX28DRAFT_1027 in Enterobacter asburiae PDN3

Annotation: ABC-type spermidine/putrescine transport systems, ATPase components

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 PF00005: ABC_tran" amino acids 21 to 162 (142 residues), 118.3 bits, see alignment E=4.1e-38 PF08402: TOBE_2" amino acids 257 to 331 (75 residues), 56.5 bits, see alignment E=2.5e-19

Best Hits

Swiss-Prot: 82% identical to YDCT_ECOLI: Uncharacterized ABC transporter ATP-binding protein YdcT (ydcT) from Escherichia coli (strain K12)

KEGG orthology group: K02052, putative spermidine/putrescine transport system ATP-binding protein (inferred from 87% identity to ent:Ent638_2127)

MetaCyc: 82% identical to putative ABC transporter ATP-binding protein YdcT (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (337 amino acids)

>EX28DRAFT_1027 ABC-type spermidine/putrescine transport systems, ATPase components (Enterobacter asburiae PDN3)
MTYAVEFNNVSRLYGDVRAVDEVTIAIRDGEFFSMLGPSGSGKTTCLRLIAGFEQLSGGT
ISIFGKEASELPPWERDVNTVFQDYALFPHMSILDNVAYGLMVKGIDKKKRHAQARDALE
KVGLSFAVARKPSQLSGGQRQRVAIARALVNEPRVLLLDEPLGALDLKLREQMQFELKKL
QQELGITFIFVTHDQGEALSMSDRVAVFNNGRIEQVDTPRDLYMRPRTPFVAGFVGTSNV
FDAGLAQKICGMEGSYSLRPEHIRLNEGGDVQVQGIVQAVQYQGAATRLELKLADGAKLL
VSQANLSETSSLSGIAPGQAVIASWSREAMIRLHEER