Protein Info for EX28DRAFT_1002 in Enterobacter asburiae PDN3

Annotation: diguanylate cyclase (GGDEF) domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 709 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 41 to 64 (24 residues), see Phobius details amino acids 76 to 97 (22 residues), see Phobius details amino acids 108 to 130 (23 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details amino acids 173 to 193 (21 residues), see Phobius details amino acids 214 to 236 (23 residues), see Phobius details PF03707: MHYT" amino acids 52 to 101 (50 residues), 66.3 bits, see alignment 2.9e-22 amino acids 118 to 168 (51 residues), 63 bits, see alignment 3e-21 amino acids 183 to 227 (45 residues), 26 bits, see alignment 1.1e-09 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 256 to 417 (162 residues), 119.2 bits, see alignment E=7.2e-39 PF00990: GGDEF" amino acids 261 to 415 (155 residues), 144.9 bits, see alignment E=2.9e-46 PF00563: EAL" amino acids 436 to 671 (236 residues), 240.7 bits, see alignment E=2.2e-75

Best Hits

KEGG orthology group: None (inferred from 85% identity to enc:ECL_01826)

Predicted SEED Role

"Sensory box/GGDEF family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (709 amino acids)

>EX28DRAFT_1002 diguanylate cyclase (GGDEF) domain (Enterobacter asburiae PDN3)
MLNISWDPVLIAISYLVAFIASFVALDSAGKIPLSSRKAALFWRIAGGVTLGIGIWSMHF
IGMLSMQMPMMMSYDLWLTLASLGVAVIASATALNIAVAGKKLSPFRLIFATAILSAGVV
SMHYIGMAALMLDGSIIWDRRIVGLSVVIAVVASGTALWLAFRLRDKHKGVFINRILAAF
VMGAAICAMHYTGMSAAQFQEMAHTLPGGIGELGLSIWVSVTTLCLLGVMLIISLIDSHR
RTSRLTDNLQQLNRQLELQARFDALTGLANRHQMDLRMQDCLRSALLSKKPFAVIFLDVD
HFKRVNDTWGHSVGDELLIAVAQRITARLTREMTLARLGGDAFILLVPECDDDRLNALVT
ALLEDVRRPLSVCGHTLSTTISAGVSLYPQDGETLHELKLKADAALHRVKEEGRNGWAIY
RAEMSTAIPAKPGFLQELSQALERDQFELWYQPTWHAGEKTIHGFEALLRWRHPEQGVVL
PNLFIPSLEQTGLIIPVGNWAIEAACRQLHFWTEQGFSQWTLSLNLSPIQFEQPDIFQII
SSMLEKYSLSPSRLILEVTESTALKNLDRSIELLNAFNHAGIVVSIDDFGTGYSNLLMLS
VLPAKELKIDRSFVTSMLENEKSYKLVETIISIARTMEMNVVAEGIETEEQQAVLTHLGC
DYLQGYLFSRPLPAEQVPWLLLQINSDKQIIPINKIQTDPAFISQKNHA