Protein Info for EX28DRAFT_0997 in Enterobacter asburiae PDN3

Annotation: L-alanine-DL-glutamate epimerase and related enzymes of enolase superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 PF02746: MR_MLE_N" amino acids 2 to 112 (111 residues), 91.4 bits, see alignment E=4.9e-30 PF13378: MR_MLE_C" amino acids 132 to 289 (158 residues), 92.6 bits, see alignment E=3.1e-30

Best Hits

Swiss-Prot: 82% identical to AEEP_ECOLI: L-Ala-D/L-Glu epimerase (ycjG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 90% identity to enc:ECL_01797)

MetaCyc: 82% identical to L-Ala-D/L-Glu epimerase (Escherichia coli K-12 substr. MG1655)
RXN0-5228 [EC: 5.1.1.20]

Predicted SEED Role

"L-alanine-DL-glutamate epimerase" in subsystem Muconate lactonizing enzyme family

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (321 amino acids)

>EX28DRAFT_0997 L-alanine-DL-glutamate epimerase and related enzymes of enolase superfamily (Enterobacter asburiae PDN3)
MRSVKVYEEAWPLHTPFVISRGSRSEASVVVVEIEEEGVKGVGECTPYPRYGESPASVMA
HIMTLVPDLQKGLTREALQQRLPAGAARNAVDCALWSLEAAMQQQSLTSLLGVALPESVV
TAQTVVIGEPEQMAASAKAIFDAGATLLKVKLDDRLISERMVVIRSAVPSATLIVDANES
WHPEGLAARCQLLADLGVAMLEQPLPAKDDAALKNFIHPLPVCADESCHTRENLSALKGS
YEMVNIKLDKTGGLTEALALAAEAQAQGFSLMLGCMLCTSRAIGAALPLVNQVRFADLDG
PTWLAVDVSPALNFTSGVLHL