Protein Info for EX28DRAFT_0992 in Enterobacter asburiae PDN3

Annotation: Predicted ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 PF04317: DUF463" amino acids 20 to 464 (445 residues), 610 bits, see alignment E=1.4e-187

Best Hits

Swiss-Prot: 92% identical to YCJX_ECOLI: Uncharacterized protein YcjX (ycjX) from Escherichia coli (strain K12)

KEGG orthology group: K06918, (no description) (inferred from 97% identity to enc:ECL_01792)

Predicted SEED Role

"Conserved protein YcjX with nucleoside triphosphate hydrolase domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (465 amino acids)

>EX28DRAFT_0992 Predicted ATPase (Enterobacter asburiae PDN3)
MKRLKNEINSLVNRGVDRHLRLAVTGLSRSGKTAFITAMVNQLLNLHAGARLPLLSAVRE
ERLLGVKRVPQRDFGIPRFTYDEGLAQLYGDPPTWPTPTRGVSEIRLALRFRSNESLMRH
FKDTSTLYLEIVDYPGEWLLDLPMLAQDYLSWSRQMTGLLQGQRAGWSAKWRQLCEGLDP
LAPADENRLAAIAEAWTAYLHQCKQEGLHFIQPGRFVLPGDLAGAPALQFFPWPNVDGVG
ESKLAQADRHTNAGMLRERYNYYCEKVVKGFYKNHFLRFDRQIVLVDCLQPLNSGPQAFN
DMRLALTQLMQSFHYGQRTLFRRLFSPVIDKLLFAATKADHVTVDQHANMVSLLQQLVQD
AWQNAAFEGIGMDCLGLASVQATQSGLIDVNGEKIPALRGNRLSDGEPLTVYPGEVPARL
PGQAFWQNQGFQFEAFRPQAMSVDRPLPHIRLDAALEFLIGDKLR