Protein Info for EX28DRAFT_0965 in Enterobacter asburiae PDN3

Annotation: ABC transporter transmembrane region

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 transmembrane" amino acids 31 to 60 (30 residues), see Phobius details amino acids 66 to 83 (18 residues), see Phobius details amino acids 133 to 152 (20 residues), see Phobius details amino acids 158 to 178 (21 residues), see Phobius details amino acids 226 to 247 (22 residues), see Phobius details amino acids 253 to 272 (20 residues), see Phobius details PF13748: ABC_membrane_3" amino acids 20 to 256 (237 residues), 259.3 bits, see alignment E=1.6e-81

Best Hits

KEGG orthology group: None (inferred from 85% identity to enc:ECL_01759)

Predicted SEED Role

"probable integral membrane protein NMA1777"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (303 amino acids)

>EX28DRAFT_0965 ABC transporter transmembrane region (Enterobacter asburiae PDN3)
MMNRNNNFRSSEPAGVMHSLKKLAIRHRKKLAVTFFLVVAENVTFLLYPVLAGIAINAIL
AGETLNAALYGLMVLCMWFIGAARRSIDTRTFARIYAGLAVSVVLAQRKYQLNHSAIAAR
VTLSREYVDFFEMHLPLLITSLSSLFGAAIMLLFIEFWAGVMCFAIVFILLGFVSGYARK
NEWLFMRLNNRLEKEVDYVHKAGTATLHRHYSALARLRIALSDREAWGYLWVGVLVAALF
TLTIVWMTRSSGITAGHIYSVMTYMWMFATSLDDAPQLLEKFSQLRDIGKRVSTDDEIHV
TGR