Protein Info for EX28DRAFT_0941 in Enterobacter asburiae PDN3

Annotation: cob(I)alamin adenosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 196 PF12557: Co_AT_N" amino acids 3 to 21 (19 residues), 26.1 bits, see alignment (E = 6.7e-10) TIGR00708: cob(I)yrinic acid a,c-diamide adenosyltransferase" amino acids 24 to 196 (173 residues), 264.1 bits, see alignment E=2.8e-83 PF02572: CobA_CobO_BtuR" amino acids 27 to 196 (170 residues), 211.6 bits, see alignment E=9.5e-67

Best Hits

Swiss-Prot: 86% identical to BTUR_ECOL6: Corrinoid adenosyltransferase (btuR) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K00798, cob(I)alamin adenosyltransferase [EC: 2.5.1.17] (inferred from 96% identity to enc:ECL_01734)

MetaCyc: 82% identical to cob(I)yrinic acid a,c-diamide adenosyltransferase subunit (Salmonella enterica enterica serovar Typhimurium)
Cob(I)yrinic acid a,c-diamide adenosyltransferase. [EC: 2.5.1.17]; 2.5.1.17 [EC: 2.5.1.17]; 2.5.1.17 [EC: 2.5.1.17]

Predicted SEED Role

"Cob(I)alamin adenosyltransferase (EC 2.5.1.17)" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis (EC 2.5.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (196 amino acids)

>EX28DRAFT_0941 cob(I)alamin adenosyltransferase (Enterobacter asburiae PDN3)
MSEERHQQRQQRLKEQVDARVAAAQDERGIVIVFTGNGKGKTTAAFGTATRAVGHGQKVG
VIQFIKGEWPNGERNLLEPHGVEFQVMATGFTWDTQNRETDTAACLAVWEHAKRMLADPS
LNMVLLDEITYMVAYDYLPLEAVLDALKNRPVHQTVIVTGRGCHRDILEMAETVSELRPV
KHAFDAGIKAQIGIDY