Protein Info for EX28DRAFT_0908 in Enterobacter asburiae PDN3

Annotation: phage tail protein, P2 protein I family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 177 TIGR01634: phage tail protein I" amino acids 7 to 143 (137 residues), 214.6 bits, see alignment E=2.3e-68 PF09684: Tail_P2_I" amino acids 7 to 143 (137 residues), 184.9 bits, see alignment E=3.6e-59

Best Hits

Swiss-Prot: 82% identical to BPI_BPP2: Baseplate protein I (I) from Escherichia phage P2

KEGG orthology group: None (inferred from 86% identity to ebr:ECB_01995)

Predicted SEED Role

"Phage tail fibers"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (177 amino acids)

>EX28DRAFT_0908 phage tail protein, P2 protein I family (Enterobacter asburiae PDN3)
MNDTRLLPVGSSPLEVAAARACAEIENTPVPLRRLWSPDDCPANLLPWLAWAFSVDRWDE
NWPEATKRDVIRAAWFIHAHKGTIGAVRRVVEPLGYLINVSEWWETNDPPGTFRLDIGVL
ETGITEEMYYEMERLIADAKPASRHLIGLNIIQDVPGYLYTGALTYDGDIITVYPDK