Protein Info for EX28DRAFT_0873 in Enterobacter asburiae PDN3

Annotation: Kef-type K+ transport systems, predicted NAD-binding component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 transmembrane" amino acids 40 to 60 (21 residues), see Phobius details amino acids 71 to 90 (20 residues), see Phobius details amino acids 101 to 123 (23 residues), see Phobius details amino acids 129 to 149 (21 residues), see Phobius details amino acids 169 to 190 (22 residues), see Phobius details amino acids 196 to 216 (21 residues), see Phobius details amino acids 228 to 251 (24 residues), see Phobius details PF00520: Ion_trans" amino acids 38 to 255 (218 residues), 110.1 bits, see alignment E=1.5e-35 PF08016: PKD_channel" amino acids 139 to 233 (95 residues), 27.2 bits, see alignment E=3.9e-10 PF07885: Ion_trans_2" amino acids 176 to 250 (75 residues), 61.2 bits, see alignment E=1.1e-20

Best Hits

KEGG orthology group: None (inferred from 92% identity to enc:ECL_01642)

Predicted SEED Role

"Potassium voltage-gated channel subfamily KQT; possible potassium channel, VIC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (289 amino acids)

>EX28DRAFT_0873 Kef-type K+ transport systems, predicted NAD-binding component (Enterobacter asburiae PDN3)
MMSALIFCEVTVSRLFTSARRRLYHFLFDPETLSGRRFEGLCGLFALLSVVVIFIESGAG
TQYHLTFDEWHIFVWLEMAITLVFTAEYFLRVIAWPNPARYVFSFWGFIDLATILPLYVM
WLWPEISLSYVFAWRAMRVIRVLRILKLLRFMPSLRVFWSAIVSARHQLILFYSFIAIVM
IVFGALMYLIEGPKYGFTTLNASVYWAIVTVTTVGYGDITPHTPLGRIVASVLILIGYSV
IAIPTGLITTHMSSAFQSRKQQRKCPHCQQGEHEHDARFCHRCGSELPE