Protein Info for EX28DRAFT_0858 in Enterobacter asburiae PDN3

Annotation: formyltetrahydrofolate deformylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01842: ACT
  • amino acids 8 to 69 (62 residues), 35.6 bits, E=6.4e-13
• TIGR00655: formyltetrahydrofolate deformylase
  • amino acids 8 to 280 (273 residues), 434.2 bits, E=1.2e-134
• PF00551: Formyl_trans_N
  • amino acids 86 to 262 (177 residues), 191.6 bits, E=1.1e-60

Best Hits

Swiss-Prot: 94% identical to PURU_ECOLI: Formyltetrahydrofolate deformylase (purU) from Escherichia coli (strain K12)

KEGG orthology group: K01433, formyltetrahydrofolate deformylase [EC: 3.5.1.10] (inferred from 98% identity to ent:Ent638_2311)

MetaCyc: 94% identical to formyltetrahydrofolate deformylase (Escherichia coli K-12 substr. MG1655)
Formyltetrahydrofolate deformylase. [EC: 3.5.1.10]

Predicted SEED Role

"Formyltetrahydrofolate deformylase (EC 3.5.1.10)" in subsystem One-carbon metabolism by tetrahydropterines (EC 3.5.1.10)

MetaCyc Pathways

• formaldehyde oxidation VII (THF pathway) (4/4 steps found)
• folate transformations I (9/13 steps found)
• purine nucleobases degradation II (anaerobic) (13/24 steps found)
• purine nucleobases degradation I (anaerobic) (6/15 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• One carbon pool by folate

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.10

Protein Sequence (280 amino acids)

>EX28DRAFT_0858 formyltetrahydrofolate deformylase (Enterobacter asburiae PDN3)
MQSLQRKVLRTICPDQKGLIARITNICYKHELNIVQNNEFVDHRTGRFFMRTELEGIFND
TTLLADLDSALPEGSVRELTPAGRRRIVILVTKEAHCLGDLLMKANYGGLDVEIAAVIGN
HETLRTLVERFDIPFELVSHEGHTREEHDDLMAQAIEAHNPDYVVLAKYMRVLTPSFVSR
FPNKIINIHHSFLPAFIGARPYHQAYERGVKIIGATAHYVNDNLDEGPIIMQDVIHVDHT
YTAEDMMRAGRDVEKNVLSRALYQVLAQRVFVYGNRTIIL