Protein Info for EX28DRAFT_0776 in Enterobacter asburiae PDN3

Annotation: Arabinose efflux permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 55 to 74 (20 residues), see Phobius details amino acids 86 to 105 (20 residues), see Phobius details amino acids 113 to 133 (21 residues), see Phobius details amino acids 144 to 164 (21 residues), see Phobius details amino acids 174 to 194 (21 residues), see Phobius details amino acids 216 to 237 (22 residues), see Phobius details amino acids 253 to 275 (23 residues), see Phobius details amino acids 283 to 304 (22 residues), see Phobius details amino acids 310 to 330 (21 residues), see Phobius details amino acids 342 to 363 (22 residues), see Phobius details amino acids 369 to 390 (22 residues), see Phobius details PF07690: MFS_1" amino acids 25 to 356 (332 residues), 126.3 bits, see alignment E=1.3e-40 PF00083: Sugar_tr" amino acids 58 to 193 (136 residues), 39.2 bits, see alignment E=4.4e-14

Best Hits

Swiss-Prot: 47% identical to NEPI_SALEP: Purine ribonucleoside efflux pump NepI (nepI) from Salmonella enteritidis PT4 (strain P125109)

KEGG orthology group: None (inferred from 96% identity to enc:ECL_01525)

Predicted SEED Role

"Arabinose efflux permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (395 amino acids)

>EX28DRAFT_0776 Arabinose efflux permease (Enterobacter asburiae PDN3)
MNSCVAASEAVAPAKPAWRAVYSLGLGVFGLITAEFLPASLLTPMAASLGVSEGMAGQAV
TATALVALVTGLLITPATKSIDRRWVLMFFSVLQIISSLLVAFAPTLHVLLMGRLLLGIA
IGGFWAMSTATTMRLVPADKVPKALAVIFSSVSIATVVAAPLGSYLGSLIGWRNVFVLCI
LPSMLALLWQLWVLPSMKPESSGSLSTLFRVLRRPGMIGGMLATILIFSGHFAFFTYLRP
FLETVGQASVETISLILLGFGLANFVGTSVAGHLLARNLRLTLALVPFAMGVLALTMVAF
GHLAMLDGFLVALWGFAFGLVPVGWSTWLATTVPDEAESAGGLLVASIQLAISAGAAGGG
AVFDLNGASGVFAGSGLLLVTAMVIVFMGVKVKAE