Protein Info for EX28DRAFT_0758 in Enterobacter asburiae PDN3

Annotation: septum site-determining protein MinC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 235 TIGR01222: septum site-determining protein MinC" amino acids 6 to 234 (229 residues), 227.9 bits, see alignment E=6.6e-72 PF05209: MinC_N" amino acids 6 to 75 (70 residues), 68.6 bits, see alignment E=4e-23 PF03775: MinC_C" amino acids 132 to 231 (100 residues), 110 bits, see alignment E=5.7e-36

Best Hits

Swiss-Prot: 91% identical to MINC_ENT38: Probable septum site-determining protein MinC (minC) from Enterobacter sp. (strain 638)

KEGG orthology group: K03610, septum site-determining protein MinC (inferred from 97% identity to enc:ECL_01503)

Predicted SEED Role

"Septum site-determining protein MinC" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (235 amino acids)

>EX28DRAFT_0758 septum site-determining protein MinC (Enterobacter asburiae PDN3)
MSNTPIELKGSSFTLSVVHLHDAKPEVIRQALEDKIAQAPAFLKHAPVVINVSGLEAPVN
WKLLQQAVSSTGLRIVGISGCKDTELKAEIERAGLPLLNEGKEKASRAAPVAVQTPPPAV
QNVTTVTKTRMIDVPVRSGQRIYAPNCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAG
ASGDRDAQIFCTHLTAELVSIAGEYWLSDKIPAEFYGKAARLLLADDALTVQPLN