Protein Info for EX28DRAFT_0746 in Enterobacter asburiae PDN3

Annotation: NUDIX domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 PF00293: NUDIX" amino acids 30 to 143 (114 residues), 59 bits, see alignment E=2.6e-20

Best Hits

Swiss-Prot: 88% identical to NUDL_CITK8: Uncharacterized Nudix hydrolase NudL (nudL) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

KEGG orthology group: None (inferred from 97% identity to enc:ECL_01491)

MetaCyc: 85% identical to putative NUDIX hydrolase with low 3-phosphohydroxypyruvate phosphatase activity (Escherichia coli K-12 substr. MG1655)
RXN0-6562

Predicted SEED Role

"Hypothetical nudix hydrolase YeaB" in subsystem Nudix proteins (nucleoside triphosphate hydrolases)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (192 amino acids)

>EX28DRAFT_0746 NUDIX domain (Enterobacter asburiae PDN3)
MEKENLTLDDFLSRFQLLRPQVNREALNQRQAAVLIPVVRRAQPGLLLTQRSPHLRKHAG
QVAFPGGAVDSSDASLIAAALREAQEEVAIPPEAVEVIGVLPPVDSVTGFQVTPVVGIIP
PGLQYHASVDEVSAVFEMPLEEALRLSRYHPLDIHRRGHDHRVWLSWYQHYFVWGMTAGI
IRELALQIGLKP