Protein Info for EX28DRAFT_0723 in Enterobacter asburiae PDN3

Annotation: integral membrane protein, PqiA family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 transmembrane" amino acids 66 to 84 (19 residues), see Phobius details amino acids 117 to 141 (25 residues), see Phobius details amino acids 162 to 179 (18 residues), see Phobius details amino acids 189 to 208 (20 residues), see Phobius details amino acids 266 to 290 (25 residues), see Phobius details amino acids 311 to 339 (29 residues), see Phobius details amino acids 353 to 378 (26 residues), see Phobius details amino acids 384 to 406 (23 residues), see Phobius details TIGR00155: integral membrane protein, PqiA family" amino acids 17 to 417 (401 residues), 627.8 bits, see alignment E=4.4e-193 PF04403: PqiA" amino acids 66 to 217 (152 residues), 123 bits, see alignment E=5.4e-40 amino acids 263 to 418 (156 residues), 150.1 bits, see alignment E=2.4e-48

Best Hits

Swiss-Prot: 82% identical to YEBS_ECOLI: Intermembrane transport protein YebS (yebS) from Escherichia coli (strain K12)

KEGG orthology group: K03808, paraquat-inducible protein A (inferred from 91% identity to ent:Ent638_2403)

Predicted SEED Role

"Paraquat-inducible protein A" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (427 amino acids)

>EX28DRAFT_0723 integral membrane protein, PqiA family (Enterobacter asburiae PDN3)
MALKTTKITPTRKITVHTVSEALPRAHYQRCPQCDTLFMLPKMKSHQSAFCPRCDAKIRD
GRDWSLTRLAAMAVTMLLLMPFAWSEPLLKLYLLGVRIDANVLQGIWQMTRQGDPITAAM
VLFCTVGAPLVLVAAIAYLWFGNILGMNLRPVLLMLDKLKEWVMLDIYLVGVGVASIKVQ
DYAFLQPGIGLFAFISLVLLSILTLIHLNVEQLWERFYPQRPATRPDENLRVCLGCHYTG
LPDARGRCPRCHIPLRLRRNNSLQKCWAALIASLVFLIPANMLPISIIYVNGGRQEDTIL
SGIISLAHSNVGVAAIVFIASILVPFTKVVVMFTLLISIHFKCEQGLRTRILLLRFVTWI
GRWSMLDLFVISLMMSLINRDQLLAFTMGPAAFYFGSAVILTILAVEWLDSRLLWDAHES
GNPRFAD