Protein Info for EX28DRAFT_0721 in Enterobacter asburiae PDN3

Annotation: NOL1/NOP2/sun family putative RNA methylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 480 PF17125: Methyltr_RsmF_N" amino acids 8 to 105 (98 residues), 96.2 bits, see alignment E=2.7e-31 TIGR00446: NOL1/NOP2/sun family putative RNA methylase" amino acids 41 to 310 (270 residues), 364.1 bits, see alignment E=1.9e-113 PF01189: Methyltr_RsmB-F" amino acids 118 to 309 (192 residues), 150 bits, see alignment E=1.4e-47 PF21150: YebU_pre-PUA_dom" amino acids 329 to 405 (77 residues), 126.5 bits, see alignment E=6.2e-41 PF13636: Methyltranf_PUA" amino acids 419 to 467 (49 residues), 52.1 bits, see alignment 1.1e-17

Best Hits

Swiss-Prot: 86% identical to RSMF_ENT38: Ribosomal RNA small subunit methyltransferase F (rsmF) from Enterobacter sp. (strain 638)

KEGG orthology group: K11392, ribosomal RNA small subunit methyltransferase F [EC: 2.1.1.-] (inferred from 90% identity to enc:ECL_01466)

MetaCyc: 81% identical to 16S rRNA m5C1407 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11593 [EC: 2.1.1.178]

Predicted SEED Role

"Ribosomal RNA small subunit methyltransferase F (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.178

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (480 amino acids)

>EX28DRAFT_0721 NOL1/NOP2/sun family putative RNA methylase (Enterobacter asburiae PDN3)
MAQNSVFLPEQFLAQMREALPSHLSLDDFIAACQRPLRRSIRVNTLKISVDDFLALVSPY
GWQLTPVPWCAEGFWIERDDEASLPLGSTAEHLSGLFYIQEASSMLPVAALFADGNAPER
VMDVAAAPGSKTTQIAARMGNHGAILANEFSASRVKVLHANISRCGIHNVALTHFDGRVF
GAALPEAFDAILLDAPCSGEGVVRKDPDALKNWSVESNLEIAATQRELIESAFHALRPGG
TLVYSTCTLNRDENEDVCLWLKANYPDAVEFLPLNDLFASAQEAVTPEGFLHVFPQIYDC
EGFFVARLRKTQAVEPLPTPKFKVGNFPFAPLKGRDAAQLEAAAKKVGLVWDESLHPWMR
DKEIWLFPAQIEPLIGKVRFSRIGIRLAEVHNKGYRWQHEAVIALAGRENTFALTHQEAE
EWYRGRDVYPDSTPSGDEVIVTYQGYPLGLAKKVGSRLKNSYPRELVRDGRLFTGNDRTA