Protein Info for EX28DRAFT_0664 in Enterobacter asburiae PDN3

Annotation: Na+/H+-dicarboxylate symporters

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 47 to 72 (26 residues), see Phobius details amino acids 84 to 104 (21 residues), see Phobius details amino acids 153 to 171 (19 residues), see Phobius details amino acids 194 to 221 (28 residues), see Phobius details amino acids 228 to 249 (22 residues), see Phobius details amino acids 296 to 320 (25 residues), see Phobius details amino acids 326 to 343 (18 residues), see Phobius details amino acids 355 to 378 (24 residues), see Phobius details PF00375: SDF" amino acids 7 to 402 (396 residues), 335.9 bits, see alignment E=1.7e-104

Best Hits

Swiss-Prot: 37% identical to DCTA_RHIL3: C4-dicarboxylate transport protein (dctA) from Rhizobium leguminosarum bv. viciae (strain 3841)

KEGG orthology group: None (inferred from 98% identity to enc:ECL_01406)

Predicted SEED Role

"Sodium:dicarboxylate symporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (421 amino acids)

>EX28DRAFT_0664 Na+/H+-dicarboxylate symporters (Enterobacter asburiae PDN3)
MASANKLTLFIVIFMLAGILSGAAIHEYASADAITAWSDNITLLTDIFLRLIKMVIAPLV
FSTLTVGIMKLGETSTIGRVGGKAMVWFISSSVLSILVGLFIVTLEHPGSGLNLTVPTEA
VDTGLAVGGMTLKAFLSHTIPTSIAGAMSNNEILQIVVFSMFFGIGGASLGQKFNAPLVA
ALDVVSHIMLKVTGYVMYVAPLAIFAAISSVIATQGLGILLNYASFIGGYYVAILLTCMV
LLAVGYMVLKKEVFRLVSMLKDPVLVAFTTSSSEAAYPKTLEQLERFGCSRNIASFVLPI
GYSFNLVGSMVYCSFASMFIAQAYNIHLSFSEVTVLMLTLMLASKGIAGVPRSSLVVLAA
TIPSFNIPVAGILLLMGIDHFLDMGRSAINVLGNGIATAMLSQNEGAREAEAEAELVKQE
A