Protein Info for EX28DRAFT_0657 in Enterobacter asburiae PDN3

Annotation: Universal stress protein UspA and related nucleotide-binding proteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 142 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF00582: Usp" amino acids 3 to 138 (136 residues), 64.3 bits, see alignment E=9.3e-22

Best Hits

Swiss-Prot: 69% identical to USPC_SALTY: Universal stress protein C (uspC) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K14064, universal stress protein C (inferred from 84% identity to ent:Ent638_2471)

Predicted SEED Role

"Universal stress protein C" in subsystem Universal stress protein family

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (142 amino acids)

>EX28DRAFT_0657 Universal stress protein UspA and related nucleotide-binding proteins (Enterobacter asburiae PDN3)
MSYSHLLVSVAVSPESHQLVARAVSIARPHNARISLITLAAEPEMYNQLAAPMLEDIREV
LQEETQQFLRELVEKAQYPVYETVIATGELNAHILDMCRKQNIDLVICGNHNHSFLSRAA
CAAKSIVASSQVDVLLVPLGGH