Protein Info for EX28DRAFT_0641 in Enterobacter asburiae PDN3

Annotation: ABC-type branched-chain amino acid transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 47 to 69 (23 residues), see Phobius details amino acids 96 to 113 (18 residues), see Phobius details amino acids 119 to 141 (23 residues), see Phobius details amino acids 148 to 166 (19 residues), see Phobius details amino acids 172 to 192 (21 residues), see Phobius details amino acids 199 to 219 (21 residues), see Phobius details amino acids 265 to 282 (18 residues), see Phobius details amino acids 314 to 339 (26 residues), see Phobius details amino acids 352 to 377 (26 residues), see Phobius details amino acids 387 to 405 (19 residues), see Phobius details PF11862: DUF3382" amino acids 13 to 109 (97 residues), 63.1 bits, see alignment E=2.5e-21 PF02653: BPD_transp_2" amino acids 117 to 402 (286 residues), 164.7 bits, see alignment E=2.5e-52

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 96% identity to enc:ECL_01380)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (425 amino acids)

>EX28DRAFT_0641 ABC-type branched-chain amino acid transport system, permease component (Enterobacter asburiae PDN3)
MMTSHGFSLKRCILDAIFSGLIALIIFGPIAGVVLDGYSFNFAGQRLAWMVGIVMLGRFL
LSAFLGTAAGARFQARFEADSAGVYVRPPEYKSRMRWIITLVITLAICFPFVATKYVLTV
AILGLIYVLLGLGLNIVVGLAGLLDLGYVAFYAIGAYGLALGYQYLGLGFWSMLPLAAIM
AAAAGALLGFPVLRMHGDYLAIVTLGFGEIIRLILNNWLTFTGGPNGVSAPPPTFFGLEF
GRRAKEGGVPFHEFFHLTYNPNMKFIFIYAVLFLVVMLVLYIKHRLTRMPIGRAWEALRE
DEIACRSMGLNHVLVKLSAFTLGASTAGIAGVFFATYQGFVNPTSFTFFESALILAIVVL
GGMGSTLGVVLAAFVLTVTPELLRSFAEYRVLLFGMLMVVMMIWRPRGLIRINRSGFAVR
KGVAP