Protein Info for EX28DRAFT_0621 in Enterobacter asburiae PDN3

Annotation: flagellar biosynthetic protein FliS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 134 TIGR00208: flagellar protein FliS" amino acids 1 to 125 (125 residues), 133.4 bits, see alignment E=2.4e-43 PF02561: FliS" amino acids 8 to 125 (118 residues), 129 bits, see alignment E=5.3e-42

Best Hits

Swiss-Prot: 70% identical to FLIS_SALTY: Flagellar secretion chaperone FliS (fliS) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02422, flagellar protein FliS (inferred from 78% identity to enc:ECL_01355)

Predicted SEED Role

"Flagellar biosynthesis protein FliS" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (134 amino acids)

>EX28DRAFT_0621 flagellar biosynthetic protein FliS (Enterobacter asburiae PDN3)
MYKTSGVQSYQQIGVESAVMNASPHQLIVMLFDGAHSALVRARLFMEAGQIREKGEALSK
AINIIDNGLKAGLNMEVESELSGNLASLYEYMVRRLLLANVSNDVDAIVEVEGLLNNIAD
AWKQIGPNASSISG