Protein Info for EX28DRAFT_0617 in Enterobacter asburiae PDN3

Annotation: flagellar hook-basal body complex protein FliE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00205: flagellar hook-basal body complex protein FliE
  • amino acids 2 to 104 (103 residues), 128.5 bits, E=7.2e-42
• PF02049: FliE
  • amino acids 19 to 104 (86 residues), 93.2 bits, E=4.5e-31

Best Hits

Swiss-Prot: 91% identical to FLIE_ENT38: Flagellar hook-basal body complex protein FliE (fliE) from Enterobacter sp. (strain 638)

KEGG orthology group: K02408, flagellar hook-basal body complex protein FliE (inferred from 98% identity to enc:ECL_03219)

Predicted SEED Role

"Flagellar hook-basal body complex protein FliE" in subsystem Flagellum or Flagellum in Campylobacter

Protein Sequence (104 amino acids)

>EX28DRAFT_0617 flagellar hook-basal body complex protein FliE (Enterobacter asburiae PDN3)
MAIQGIEGVISQLQATAMTARNQNVADQQPSISFAGQLHAALDRISDTQTAARTQAEKFT
LGEPGVALNDVMTDLQKASVSLQMGIQVRNKLVSAYQEVMGMQV