Protein Info for EX28DRAFT_0606 in Enterobacter asburiae PDN3

Annotation: flagellar biosynthetic protein FliP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 45 to 74 (30 residues), see Phobius details amino acids 86 to 105 (20 residues), see Phobius details amino acids 184 to 209 (26 residues), see Phobius details amino acids 219 to 242 (24 residues), see Phobius details TIGR01103: flagellar biosynthetic protein FliP" amino acids 47 to 243 (197 residues), 316.1 bits, see alignment E=4.6e-99 PF00813: FliP" amino acids 48 to 239 (192 residues), 279.6 bits, see alignment E=7.8e-88

Best Hits

Swiss-Prot: 91% identical to FLIP_SALTY: Flagellar biosynthetic protein FliP (fliP) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02419, flagellar biosynthetic protein FliP (inferred from 99% identity to enc:ECL_03230)

Predicted SEED Role

"Flagellar biosynthesis protein FliP" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (245 amino acids)

>EX28DRAFT_0606 flagellar biosynthetic protein FliP (Enterobacter asburiae PDN3)
MRRLLSLTLAGVALFAPAVYAQLPGLVSTPLAGGGQSWSLPVQTLVFITSLTFIPAILLM
MTSFTRIIIVFGLLRNALGTPSAPPNQVLLGLALFLTFFIMSPVIDKIYTDAYQPFSEDK
ISMQEALDKGAQPLREFMLRQTREADLALFARLSNTGELQGPESVPMRILLPAYVTSELK
TAFQIGFTIFIPFLIIDLVIASVLMALGMMMVPPATIALPFKIMLFVLVDGWQLLVSSLA
QSFYS