Protein Info for EX28DRAFT_0604 in Enterobacter asburiae PDN3

Annotation: flagellar biosynthetic protein FliR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 transmembrane" amino acids 13 to 33 (21 residues), see Phobius details amino acids 44 to 63 (20 residues), see Phobius details amino acids 65 to 65 (1 residues), see Phobius details amino acids 72 to 95 (24 residues), see Phobius details amino acids 128 to 149 (22 residues), see Phobius details amino acids 176 to 201 (26 residues), see Phobius details amino acids 212 to 236 (25 residues), see Phobius details TIGR01400: flagellar biosynthetic protein FliR" amino acids 15 to 254 (240 residues), 264.7 bits, see alignment E=4.1e-83 PF01311: Bac_export_1" amino acids 15 to 246 (232 residues), 229.7 bits, see alignment E=1.9e-72

Best Hits

Swiss-Prot: 81% identical to FLIR_SALTY: Flagellar biosynthetic protein FliR (fliR) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02421, flagellar biosynthetic protein FliR (inferred from 96% identity to enc:ECL_03232)

Predicted SEED Role

"Flagellar biosynthesis protein FliR" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (261 amino acids)

>EX28DRAFT_0604 flagellar biosynthetic protein FliR (Enterobacter asburiae PDN3)
MLHFTSDQWVQWLGVYFWPMLRIMALISTAPILSEKSIPKRVKVGLGIIISIIVAPSLPP
VDIPIFSANAVWVALQQVMIGVAVGFTMQLAFAAVRTAGELIGLQMGLSFATFVDPGSHL
NMPVLARIIDLLAMLLFLSFNGHLWLISMLVDTFHTLPIGENPVNSNAFLALTRAAGLIF
LNGLMLALPIITLLLTVNLALGLLNRMAPQLSVFVIGFPLTLTVGILLMSLLMPLIAPFC
EHLFGEIFNLLADIVSELPRK