Protein Info for EX28DRAFT_0603 in Enterobacter asburiae PDN3

Annotation: Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 transmembrane" amino acids 79 to 97 (19 residues), see Phobius details PF00196: GerE" amino acids 137 to 191 (55 residues), 68.1 bits, see alignment E=2.1e-23

Best Hits

Swiss-Prot: 88% identical to RCSA_ECOLX: Transcriptional regulatory protein RcsA (rcsA) from Escherichia coli

KEGG orthology group: K07781, LuxR family transcriptional regulator, capsular biosynthesis positive transcription factor (inferred from 99% identity to enc:ECL_03233)

Predicted SEED Role

"Colanic acid capsular biosynthesis activation accesory protein RcsA, co-regulator with RcsB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (207 amino acids)

>EX28DRAFT_0603 Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain (Enterobacter asburiae PDN3)
MSTIIMDLCSYTRLGLTGYLASRGVKKRDINDAHTVDELAAACDELKPGVVFINEDCFIH
DPANSQHIKQIINQHPKTLFIVFMAIANIHFDEYLLVRKNLLISSKSIKPESLDDILGDY
LNKEVKNVGAVNLPTLSLSRTESSMLRMWMAGQGTIQISDQMNIKAKTVSSHKGNIKRKI
KTHNKQVIYHVVRLTDNVTNGIFVNMR