Protein Info for EX28DRAFT_0603 in Enterobacter asburiae PDN3

Annotation: Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00196: GerE
  • amino acids 137 to 191 (55 residues), 68.1 bits, E=2.1e-23

Best Hits

Swiss-Prot: 88% identical to RCSA_ECOLX: Transcriptional regulatory protein RcsA (rcsA) from Escherichia coli

KEGG orthology group: K07781, LuxR family transcriptional regulator, capsular biosynthesis positive transcription factor (inferred from 99% identity to enc:ECL_03233)

Predicted SEED Role

"Colanic acid capsular biosynthesis activation accesory protein RcsA, co-regulator with RcsB"

Protein Sequence (207 amino acids)

>EX28DRAFT_0603 Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain (Enterobacter asburiae PDN3)
MSTIIMDLCSYTRLGLTGYLASRGVKKRDINDAHTVDELAAACDELKPGVVFINEDCFIH
DPANSQHIKQIINQHPKTLFIVFMAIANIHFDEYLLVRKNLLISSKSIKPESLDDILGDY
LNKEVKNVGAVNLPTLSLSRTESSMLRMWMAGQGTIQISDQMNIKAKTVSSHKGNIKRKI
KTHNKQVIYHVVRLTDNVTNGIFVNMR