Protein Info for EX28DRAFT_0599 in Enterobacter asburiae PDN3

Annotation: mannosyl-3-phosphoglycerate phosphatase-related protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 TIGR01484: HAD hydrolase, family IIB" amino acids 9 to 227 (219 residues), 101.5 bits, see alignment E=1.1e-32 TIGR01486: mannosyl-3-phosphoglycerate phosphatase family" amino acids 9 to 265 (257 residues), 281.9 bits, see alignment E=6.8e-88 TIGR02463: mannosyl-3-phosphoglycerate phosphatase homolog" amino acids 9 to 229 (221 residues), 282.1 bits, see alignment E=4.8e-88 PF08282: Hydrolase_3" amino acids 10 to 228 (219 residues), 43.7 bits, see alignment E=2.9e-15 PF05116: S6PP" amino acids 76 to 264 (189 residues), 31.4 bits, see alignment E=1.5e-11

Best Hits

Swiss-Prot: 63% identical to MPGP_SALPA: Mannosyl-3-phosphoglycerate phosphatase (yedP) from Salmonella paratyphi A (strain ATCC 9150 / SARB42)

KEGG orthology group: K07026, mannosyl-3-phosphoglycerate phosphatase [EC: 3.1.3.70] (inferred from 88% identity to enc:ECL_03236)

Predicted SEED Role

"Putative mannosyl-3-phosphoglycerate phosphatase (EC 3.1.3.70)" (EC 3.1.3.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.70

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (266 amino acids)

>EX28DRAFT_0599 mannosyl-3-phosphoglycerate phosphatase-related protein (Enterobacter asburiae PDN3)
MPSLRDTLLIFSDLDGSLLDIHTYEWQPAMPWLDRLMDNQVPVILCSSKTAAEMLDLQLD
LGLEGLPFIAENGAVIQPDVRWDKIQRQIRGMTHRDIRPRIEQIRLQTGYKFTTFDDVDE
HVISEWTGLTRYRSALARKHEASVTLIWRDTDEKMVQFEEELANAGLKCLQGARFWHVLD
ARCGKDVAVNWLIEQYREQEEIEPTTLGLGDGPNDAPLLDSVDFAVVIKGINRQGITLRD
DNPARVYHTRQPGPAGWQEGLDHFLS