Protein Info for EX28DRAFT_0583 in Enterobacter asburiae PDN3

Annotation: metabolite-proton symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 transmembrane" amino acids 29 to 46 (18 residues), see Phobius details amino acids 54 to 78 (25 residues), see Phobius details amino acids 88 to 109 (22 residues), see Phobius details amino acids 121 to 143 (23 residues), see Phobius details amino acids 164 to 180 (17 residues), see Phobius details amino acids 192 to 208 (17 residues), see Phobius details amino acids 232 to 257 (26 residues), see Phobius details amino acids 277 to 295 (19 residues), see Phobius details amino acids 306 to 326 (21 residues), see Phobius details amino acids 333 to 354 (22 residues), see Phobius details amino acids 367 to 390 (24 residues), see Phobius details amino acids 403 to 420 (18 residues), see Phobius details PF00083: Sugar_tr" amino acids 21 to 225 (205 residues), 88.1 bits, see alignment E=6.2e-29 amino acids 224 to 420 (197 residues), 40.9 bits, see alignment E=1.3e-14 PF07690: MFS_1" amino acids 22 to 376 (355 residues), 99.1 bits, see alignment E=2.5e-32 amino acids 278 to 428 (151 residues), 39.3 bits, see alignment E=3.9e-14 TIGR00883: MFS transporter, metabolite:H+ symporter (MHS) family protein" amino acids 23 to 413 (391 residues), 467.1 bits, see alignment E=2.6e-144

Best Hits

Swiss-Prot: 89% identical to CITH_KLEPN: Citrate-proton symporter (citH) from Klebsiella pneumoniae

KEGG orthology group: K03288, MFS transporter, MHS family, citrate/tricarballylate:H+ symporter (inferred from 91% identity to pam:PANA_0059)

MetaCyc: 68% identical to propane-1,2,3-tricarboxylate-proton symporter (Salmonella enterica enterica serovar Typhimurium str. LT2)
RXN1R65-49

Predicted SEED Role

"metabolite/H symporter, major facilitator superfamily (MFS)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (437 amino acids)

>EX28DRAFT_0583 metabolite-proton symporter (Enterobacter asburiae PDN3)
MFSSTSPATVRSKAGAILRVTSGNFLEQFDFFLFGFYATYIAHTFFPASSEFASLMMTFA
VFGAGFLMRPIGAIVLGAYIDKVGRRKGLIVTLSIMAAGTFLIVLIPSYQSIGLWAPLLV
LTGRLLQGFSAGAELGGVSVYLAEIATPGRKGFYTSWQSGSQQVAIMVAAAMGFTLNALM
EESAIREWGWRIPFLFGCLIVPFIFFLRRKLEETEEFSARRQHLEMRQVFKTLLGNWQVV
VAGMLMVAMTTTAFYLITVYAPTFGKKVLMLSASDSLLVTLLVAISNFIWLPVGGALSDR
FGRKPVLIAMALLALATSYPALTLLASAPSFSMMLSVLLWLSFLYGLYNGAMIPALTEIM
PAEVRVAGFSLAYSLATAVFGGFTPVMSTALIEYTGDKASPGYWMSFAAVCALLATLYLY
RRRAVSLHNTVKSQGAV