Protein Info for EX28DRAFT_0582 in Enterobacter asburiae PDN3

Annotation: ABC-type molybdate transport system, periplasmic component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF13531: SBP_bac_11" amino acids 26 to 252 (227 residues), 162.2 bits, see alignment E=1.7e-51

Best Hits

Swiss-Prot: 49% identical to AIS_PSESP: Aconitate isomerase (ais) from Pseudomonas sp.

KEGG orthology group: K02020, molybdate transport system substrate-binding protein (inferred from 72% identity to enc:ECL_03257)

Predicted SEED Role

"Hypothetical ABC transport system, periplasmic component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (262 amino acids)

>EX28DRAFT_0582 ABC-type molybdate transport system, periplasmic component (Enterobacter asburiae PDN3)
MKRTYRFTASALVLTLLSVNACAQDVKVMISGGFKAALEKLAPDYERRTGDKIVIIPGPS
MGATPQAIPNRLARGEKADVVIMVGDALEKLEKAGQTQPGSRTELADSPVGMVVKKGADV
PDISSEAALRKTLLQASSIAYSDSASGRYVSQTLFKKMGIDKEVAGKATMVERIPVASEV
AKGKYAVGFQQVSELLPVQGVTFIGKIPDNLQYITRFAGAVTRHAEHPAEGKALLTYLAS
PPSRAVIEKTGMLPVTSGDTAR