Protein Info for EX28DRAFT_0532 in Enterobacter asburiae PDN3

Annotation: Chain length determinant protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 transmembrane" amino acids 32 to 51 (20 residues), see Phobius details amino acids 296 to 315 (20 residues), see Phobius details PF02706: Wzz" amino acids 17 to 120 (104 residues), 67.4 bits, see alignment E=5.9e-23

Best Hits

Swiss-Prot: 68% identical to WZZB_SALTY: Chain length determinant protein (wzzB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K05789, chain length determinant protein (polysaccharide antigen chain regulator) (inferred from 81% identity to enc:ECL_03347)

Predicted SEED Role

"regulator of length of O-antigen component of lipopolysaccharide chains" in subsystem KDO2-Lipid A biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (326 amino acids)

>EX28DRAFT_0532 Chain length determinant protein (Enterobacter asburiae PDN3)
MTQNNNSPVSRSNDPEHIDLFDLMLQLWRGKWTIAIFVVVFIAMAIGYLAFAKEKWTSRA
IIAQPDAAQIATYSNALNILYGSAAPSMLDIQTRAIGRFNSSFSALSQALDNQDVPEKLT
IEPAVKGETLPLSVTYTSTSAEAAQKQLAQYIQQVDGQTAKELALDLKDNIKEQIKTLND
SLVSQEKVAQEQKDLRIKQIAEALKNAEAAKITSPRIQQTQDVTQETMFLLGSDGLKSMI
DNEASRPLIFSAAYYQTKQNLLDIQNLNVNPDTIHVYRYVMKPDLPVHRDSPKKPIILIL
AVLLGLMMGSVVVLARNGIRNYKPKA