Protein Info for EX28DRAFT_0504 in Enterobacter asburiae PDN3

Annotation: ADP-ribose pyrophosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 PF00293: NUDIX" amino acids 18 to 143 (126 residues), 71.1 bits, see alignment E=4.8e-24

Best Hits

Swiss-Prot: 82% identical to GMM_ECOLI: GDP-mannose mannosyl hydrolase (gmm) from Escherichia coli (strain K12)

KEGG orthology group: K03207, colanic acid biosynthesis protein WcaH [EC: 3.6.1.-] (inferred from 97% identity to enc:ECL_03374)

MetaCyc: 82% identical to GDP-mannose mannosyl hydrolase (Escherichia coli K-12 substr. MG1655)
GDP-glucosidase. [EC: 3.2.1.42]; 3.2.1.42 [EC: 3.2.1.42]

Predicted SEED Role

"GDP-mannose mannosyl hydrolase (EC 3.6.1.-)" in subsystem Colanic acid biosynthesis or Mannose Metabolism or Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.2.1.42 or 3.6.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (159 amino acids)

>EX28DRAFT_0504 ADP-ribose pyrophosphatase (Enterobacter asburiae PDN3)
MFLSQEDFATVVRSTPLISIDLIVENERGEFLLGKRTNRPAQGFWFVPGGRVQKDETLSD
AFERLTLAELGLQLPMAAGQFYGVWQHFYDDNFSGTGFTTHYIVLGFRLKVSEADLRLPD
SQHDDYRWQTPEALLASDNVHDNSRAYFLAERQAEVPGI