Protein Info for EX28DRAFT_0503 in Enterobacter asburiae PDN3

Annotation: Nucleoside-diphosphate-sugar epimerases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 PF04321: RmlD_sub_bind" amino acids 5 to 64 (60 residues), 27.4 bits, see alignment E=2.7e-10 PF01370: Epimerase" amino acids 6 to 231 (226 residues), 222.2 bits, see alignment E=1e-69 PF16363: GDP_Man_Dehyd" amino acids 40 to 307 (268 residues), 67.6 bits, see alignment E=2.1e-22

Best Hits

Swiss-Prot: 92% identical to FCL_ECOLI: GDP-L-fucose synthase (fcl) from Escherichia coli (strain K12)

KEGG orthology group: K02377, GDP-L-fucose synthase [EC: 1.1.1.271] (inferred from 100% identity to enc:ECL_03375)

MetaCyc: 92% identical to GDP-L-fucose synthase (Escherichia coli K-12 substr. MG1655)
GDP-L-fucose synthase. [EC: 1.1.1.271]

Predicted SEED Role

"GDP-L-fucose synthetase (EC 1.1.1.271)" in subsystem Capsular heptose biosynthesis or Colanic acid biosynthesis (EC 1.1.1.271)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.271

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (321 amino acids)

>EX28DRAFT_0503 Nucleoside-diphosphate-sugar epimerases (Enterobacter asburiae PDN3)
MTKQRIFVAGHRGMVGSAIVRQLEQRGDVEVVVRTRDELNLLDSRAVQDFFANERIDQVY
LAAAKVGGIVANNTYPADFIYENMMIESNIIHAAHLHNVNKLLFLGSSCIYPKMAKQPIA
ESELLQGTLEATNEPYAIAKIAGIKLCESYNRQYNRDYRSVMPTNLYGPHDNFHPSNSHV
IPALLRRFHEATAENAPDVVVWGSGTPMREFLHVDDMAAASIHVMELDREVWQENTEPML
SHINVGTGVDCTIRELAQTIAQVVGYKGRVVFDATKPDGTPRKLLDVTRLHQLGWYHEVS
LEQGLASTYQWFLENQHRFRG