Protein Info for EX28DRAFT_0493 in Enterobacter asburiae PDN3

Annotation: Periplasmic protein involved in polysaccharide export

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF02563: Poly_export" amino acids 82 to 165 (84 residues), 91.5 bits, see alignment E=4.6e-30 PF10531: SLBB" amino acids 173 to 223 (51 residues), 30.5 bits, see alignment 4e-11 PF18412: Wza_C" amino acids 347 to 376 (30 residues), 58.7 bits, see alignment (E = 5.6e-20)

Best Hits

Swiss-Prot: 95% identical to WZA_SALTY: Putative polysaccharide export protein wza (wza) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01991, polysaccharide export outer membrane protein (inferred from 95% identity to ent:Ent638_2676)

MetaCyc: 93% identical to outer membrane polysaccharide export protein Wza (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Polysaccharide export lipoprotein Wza" in subsystem Colanic acid biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (379 amino acids)

>EX28DRAFT_0493 Periplasmic protein involved in polysaccharide export (Enterobacter asburiae PDN3)
MMKSKMKLMPLLVSVTLMSGCTVFPGSNMSTMGKDVIKQQDADFDLDKMVNVYPLTPRLV
EQLRPRPNVAQPNMSLDQEIASYQYRVGPGDVINVTVWDHPELTTPAGQYRSSSDTGNWV
QSDGTMFYPYIGKVHVAGKTLAEIRSDITGRLAQYIADPQVDVNIAAFRSQKAYISGQVN
KSGQQAITNVPLTVLDAINAAGGLTDGADWRNVVLTHNGKEQRISLQALMQNGDLTQNRL
LYPGDILYVPRNDDLKVFVMGEVKKQSTLKMDFSGMTLTEALGNAEGIDLTTSNATGIFV
IRPLKGEGSAKGKIANIYQLDMSDATSLVMATEFRLQPYDVVYVTTAPVARWNRLINQLL
PTISGVRYMTDTARDIHTW