Protein Info for EX28DRAFT_0481 in Enterobacter asburiae PDN3

Annotation: Arabinose efflux permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 471 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 45 to 68 (24 residues), see Phobius details amino acids 76 to 96 (21 residues), see Phobius details amino acids 102 to 123 (22 residues), see Phobius details amino acids 133 to 157 (25 residues), see Phobius details amino acids 163 to 185 (23 residues), see Phobius details amino acids 197 to 214 (18 residues), see Phobius details amino acids 220 to 242 (23 residues), see Phobius details amino acids 263 to 282 (20 residues), see Phobius details amino acids 287 to 309 (23 residues), see Phobius details amino acids 328 to 346 (19 residues), see Phobius details amino acids 352 to 372 (21 residues), see Phobius details amino acids 393 to 416 (24 residues), see Phobius details amino acids 431 to 451 (21 residues), see Phobius details PF07690: MFS_1" amino acids 15 to 405 (391 residues), 167.8 bits, see alignment E=3.4e-53 amino acids 268 to 458 (191 residues), 41.4 bits, see alignment E=9.1e-15 PF05977: MFS_3" amino acids 21 to 171 (151 residues), 35.6 bits, see alignment E=4.1e-13

Best Hits

Swiss-Prot: 89% identical to MDTD_ENT38: Putative multidrug resistance protein MdtD (mdtD) from Enterobacter sp. (strain 638)

KEGG orthology group: None (inferred from 94% identity to enc:ECL_03404)

Predicted SEED Role

"Multidrug transporter MdtD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (471 amino acids)

>EX28DRAFT_0481 Arabinose efflux permease (Enterobacter asburiae PDN3)
MTDLPANVRWQLWIVAFGFFMQSLDTTIVNTALPSMAKSLGESPLHMHMVIVSYVLTVAV
MLPASGWLADKVGVRNIFFTAIVLFTTGSLFCAQANTLDQLVMARVLQGVGGAMMVPVGR
LTVMKIVPREQYMAAMTFVTLPGQVGPLLGPALGGILVEYASWHWIFLINLPVGIIGAIA
TLTLMPNYKMQTRRFDFFGFILLAAGMATLTLALDGQKGLGISPLTLGLLIALGVTAILW
YLRHARGNDKALFSLNLFKNPTYRLGLFGSFAGRVGSGMLPFMTPVFLQIGMGFSPFHAG
LMMIPMVLGSMGMKRIVVQVVNRFGYRHVLVTATLGLALVSLLFMGVALMGWYYVLPLVL
FCQGIVNSMRFSSMNTLTLKDLPDELASSGNSLLSMIMQLSMSVGVTIAGLLLGMYGQHH
LSVDTPVAHQVFLYTYLSMAVIIALPAFIFARVPDDTSKNVVIRRGKRSGS