Protein Info for EX28DRAFT_0383 in Enterobacter asburiae PDN3

Annotation: ABC-type uncharacterized transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 transmembrane" amino acids 9 to 29 (21 residues), see Phobius details amino acids 134 to 156 (23 residues), see Phobius details amino acids 168 to 195 (28 residues), see Phobius details amino acids 224 to 246 (23 residues), see Phobius details amino acids 282 to 308 (27 residues), see Phobius details amino acids 329 to 354 (26 residues), see Phobius details PF00528: BPD_transp_1" amino acids 152 to 359 (208 residues), 137 bits, see alignment E=3.1e-44

Best Hits

Swiss-Prot: 94% identical to YEJB_ECO57: Inner membrane ABC transporter permease protein YejB (yejB) from Escherichia coli O157:H7

KEGG orthology group: K13894, microcin C transport system permease protein (inferred from 98% identity to enc:ECL_03497)

MetaCyc: 94% identical to putative oligopeptide ABC transporter membrane subunit YejB (Escherichia coli K-12 substr. MG1655)
3.6.3.23-RXN [EC: 7.4.2.6]

Predicted SEED Role

"Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (364 amino acids)

>EX28DRAFT_0383 ABC-type uncharacterized transport system, permease component (Enterobacter asburiae PDN3)
MGAYLIRRLLLVIPTLWAIITINFFIVQIAPGGPVDQAIAAIEFGNSGGMPGGGGEGMGA
SHARTGVGNISESHYRGGRGLDPEVIAEITHRYGFDKPIHERYFKMLWDYIRFDFGDSLF
RSASVLTLIKQSLPVSITLGLWGTLIIYLVSIPLGIRKAVYNGSRFDIWSSTFIIIGYAI
PAFLFAVLLIVFFAGGSYFDLFPLRGLVSADFSSLPWYQKITDYLWHITLPVLATVIGGF
AALTMLTKNAFLDEIRKQYVVTARAKGVSEKQIMWKHVFRNAMLLVIAGFPATFIGMFFT
GSLLIEVMFSLNGLGLLGYEATVSRDYPVMFGTLYIFTLIGLLLNIISDISYTLVDPRID
FEGR